PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941568.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 305aa    MW: 34530.5 Da    PI: 8.4724
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941568.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52111411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                     lppGfrFhP+deelv++yL+k+v+g+     ++   ++ +vd++k+ePwdLp+++  + kewyfFs rd+kyatg+r+nratksgyWkatgkd+e
  XP_010941568.1  11 LPPGFRFHPRDEELVCDYLAKRVSGDGgngsFHGCPMMIDVDLNKCEPWDLPEMACVGGKEWYFFSLRDRKYATGQRTNRATKSGYWKATGKDRE 105
                     79**********************999776644445799*************7667799************************************ PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     v +  + l+g++ktLvfy+grapkg+ktdWvmhe+r+
  XP_010941568.1 106 VRR-CRLLIGMRKTLVFYQGRAPKGKKTDWVMHEFRM 141
                     *99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-603166IPR003441NAC domain
PROSITE profilePS5100556.7411166IPR003441NAC domain
PfamPF023653.4E-2712141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSFFSMVEAR LPPGFRFHPR DEELVCDYLA KRVSGDGGNG SFHGCPMMID VDLNKCEPWD  60
LPEMACVGGK EWYFFSLRDR KYATGQRTNR ATKSGYWKAT GKDREVRRCR LLIGMRKTLV  120
FYQGRAPKGK KTDWVMHEFR MEGPSNPPKF SFASKEDWVL CRVFYKSRGV ASKPITETCY  180
DDSGSSALPP LMDTYITFDQ APPSLDGHEQ VPCFSNLPLN LASHLPNAID PTIPMVERSL  240
PTKISAHKGS LPDMGSCDKK DIRAVLKHLT KLEDNPKREV HPNLGQGSLE TYLTENGLSH  300
IWNTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-47617315174NAC domain-containing protein 19
3swp_C2e-47617315174NAC domain-containing protein 19
3swp_B2e-47617315174NAC domain-containing protein 19
3swp_A2e-47617315174NAC domain-containing protein 19
3swm_D2e-47617315174NAC domain-containing protein 19
3swm_C2e-47617315174NAC domain-containing protein 19
3swm_B2e-47617315174NAC domain-containing protein 19
3swm_A2e-47617315174NAC domain-containing protein 19
4dul_B2e-47617312171NAC domain-containing protein 19
4dul_A2e-47617312171NAC domain-containing protein 19
1ut7_B2e-47617312171NO APICAL MERISTEM PROTEIN
1ut7_A2e-47617312171NO APICAL MERISTEM PROTEIN
1ut4_B2e-47617312171NO APICAL MERISTEM PROTEIN
1ut4_A2e-47617312171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941568.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-107NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM0TBT01e-140M0TBT0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31350_0011e-139(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-108NAC domain containing protein 1